PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr036590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 348aa    MW: 38446.6 Da    PI: 4.8104
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr036590.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.2e-142673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l  +    G g+W+ +ar  g+ R++k+c++rw +yl
      Pbr036590.1 26 KGLWSPEEDDKLMSYMINNGQGCWSDVARNAGLQRCGKSCRLRWINYL 73
                     678*******************************************97 PP

2Myb_DNA-binding52.21.4e-1679122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++++ +lG++ W+ Ia++++ gRt++++k++w++
      Pbr036590.1  79 RGAFSPQEEELIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 122
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4012173IPR017930Myb domain
SuperFamilySSF466891.91E-2724120IPR009057Homeodomain-like
SMARTSM007177.1E-102575IPR001005SANT/Myb domain
PfamPF002493.6E-132673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-222780IPR009057Homeodomain-like
CDDcd001671.31E-82973No hitNo description
PROSITE profilePS5129425.91874128IPR017930Myb domain
SMARTSM007174.9E-1678126IPR001005SANT/Myb domain
PfamPF002492.2E-1579122IPR001005SANT/Myb domain
CDDcd001671.04E-1181121No hitNo description
Gene3DG3DSA:1.10.10.604.4E-2681129IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MRKPEPSSAP AGKNNKENNS NSKLRKGLWS PEEDDKLMSY MINNGQGCWS DVARNAGLQR  60
CGKSCRLRWI NYLRPDLKRG AFSPQEEELI IHLHSLLGNR WSQIAARLPG RTDNEIKNFW  120
NSTIKKRLKN LSSSNGSPNA SDSSSEPKDH CAMVTGGFIS PGQEHGMLPI YMDSTPSFMQ  180
STILNHMFDP LPMLDINHGG LTFPGAGGYH NANPCITQRE IEVVVGGVGD CYNFGENGVF  240
GSGDVDIGVE GEIFVPPLES VSTEDQNIKT ETIFGDHRNP SSSNNNNYYN NINSILTCNK  300
NIKGESITGV GNYFDDDQEE LTMGDWDLED LMKDVSSSSF PYLDYQS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27241285108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744680.0DQ074468.1 Malus x domestica MYB20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009343724.10.0PREDICTED: transcription factor MYB46-like
RefseqXP_009343725.10.0PREDICTED: transcription factor MYB46-like
SwissprotQ9LXV22e-70MYB46_ARATH; Transcription factor MYB46
TrEMBLQ2LME40.0Q2LME4_MALDO; MYB20
STRINGGLYMA12G06180.21e-117(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.13e-60myb domain protein 46